Price list
Loading the price list
The three fastest movers, at trade price
The three lines most resellers start with, at the per-box price everyone pays. Per sealed box of 10 vials in USD, DAP, delivered in the United States. Everything else on the list is priced off the same rule; volume above the list is quoted.
- Certificate of analysis on every batch. Purity 98.0% minimum by RP-HPLC.
- Dispatch 1 to 2 business days from cleared payment for lines on the shelf, 4 weeks made to order, special orders dated by the desk.
- Minimum order $300.00 USD, one sealed box per line. First order from $100.00 USD.
- Settlement by credit card, Wise, wire transfer, Bitcoin, or USDT on Tron or Ethereum, against a proforma invoice.
Supplied for laboratory research use only, sold to businesses only. How a batch is made and released · How trade supply works · Canadian buyer? Switch to CAD
Quick order pad
For buyers who already know their codes. Enter a code and a box quantity per line, or paste straight out of a spreadsheet. Figures in USD.
Checkout
Four steps. You pay at the last step, by credit card, Wise, wire transfer, Bitcoin, or USDT on Tron or Ethereum; nothing is charged automatically. Figures in USD.
Dashboard
Balance, recent orders and the lines you buy most.
TB-500 (thymosin beta-4 acetate) wholesale
| Name | Thymosin beta-4 (TB-500) |
|---|---|
| Product codes | TB2, TB5, TB10 |
| Description | Synthetic 43-residue peptide, N-acetylated |
| CAS number | 77591-33-4 |
| Molecular formula | C212H350N56O78S |
| Molecular weight | 4963.51 g/mol |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES 43 residues, N-terminal acetyl. Formula and weight above are calculated from this sequence. |
| Presentations | 2mg to 10mg a vial, 10 vials per box |
Every batch of every size is tested against these limits before it is released to stock. A batch that fails any line is quarantined and does not ship.
| Appearance | White to off-white lyophilised powder or cake, free from foreign matter |
|---|---|
| Identity | Retention time by RP-HPLC against the reference standard, confirmed by ESI-MS |
| Purity | Not less than 98.0 percent by RP-HPLC, area normalisation at 220 nm |
| Related substances | Any single related substance not more than 1.0 percent |
| Water content | Not more than 8.0 percent by Karl Fischer |
| Acetate content | Not more than 15.0 percent by ion chromatography, where supplied as the acetate |
| Residual solvents | Acetonitrile not more than 410 ppm, TFA not more than 1.0 percent by GC and ion chromatography |
| Bacterial endotoxin | Reported on the certificate by LAL where the line is tested |
| Net content | Labelled peptide content per vial, plus or minus 5 percent by weight |
| Container and closure | 2 mL clear moulded glass vial, bromobutyl stopper, aluminium flip-off seal |
| Storage | Minus 20 degrees Celsius, protected from light and moisture. Short transit at ambient is tolerated. |
| Shelf life | 24 months from manufacture at minus 20 degrees Celsius, retest date on every certificate |
| Reconstitution | Reconstitute with bacteriostatic or sterile water. Do not shake. Once reconstituted, hold at 2 to 8 degrees Celsius. |
Prices and shelf states for the 3 sizes of TB-500 (thymosin beta-4 acetate) as of , the last day any of them changed.
The TB-500 (thymosin beta-4 acetate) ladder in figures
TB-500 (thymosin beta-4 acetate) is listed in 3 sizes, 2mg to 10mg a vial, every one a sealed box of 10 vials priced in USD: $68.00 for TB5 (5mg x 10vials) up to $99.00 for TB10 (10mg x 10vials), which is $6.80 to $9.90 a vial.
Per mg the cheapest size is TB10 (10mg x 10vials) at $0.990 /mg and the dearest is TB2 (2mg x 10vials) at $1.40 /mg, 29 percent apart. The per-mg figure falls at every step up in vial size, so the largest vial, TB10, is also the best priced.
2 of the 3 sizes (TB5, TB10) are on the shelf in the United States today and leave 1 to 2 business days after payment clears; TB2 is a special order, brought in on a 50-box minimum.
What every batch of TB-500 (thymosin beta-4 acetate) is released against
The 3 sizes share one specification; the size changes the fill, never the limits: purity: not less than 98.0 percent by RP-HPLC, area normalisation at 220 nm; identity: retention time by RP-HPLC against the reference standard, confirmed by ESI-MS; related substances: any single related substance not more than 1.0 percent; water: not more than 8.0 percent by Karl Fischer; content: labelled peptide content per vial, plus or minus 5 percent by weight. Every batch is tested against the whole list before release and its certificate carries each result beside its limit; the batch number on the certificate is the one on the vial label.
Look up a batch number to pull its certificate.
Certificates of analysis
Recent third-party certificates for TB-500 (thymosin beta-4 acetate), 3 sizes shown, each with its batch number and purity, released by an independent laboratory. Open any one on the certificate page, or look up any batch there by its number.
TB-500 (thymosin beta-4 acetate): what buyers ask
Which size of TB-500 (thymosin beta-4 acetate) costs least per mg?
TB10, 10mg x 10vials, at $0.990 /mg; a box of it is $99.00, $9.90 a vial. It is also the largest vial listed.
What does the cheapest box of TB-500 (thymosin beta-4 acetate) cost, and the dearest?
$68.00 for TB5 (5mg x 10vials), $6.80 a vial, and $99.00 for TB10 (10mg x 10vials), $9.90 a vial, in USD per sealed box of 10. Freight included on orders of $1,000.00 and over, quoted at checkout below that.
Which sizes of TB-500 (thymosin beta-4 acetate) are on the shelf today?
TB5, TB10 are on the shelf in the United States, and leave 1 to 2 business days after payment clears; TB2 is a special order, brought in on a 50-box minimum.
Do all 3 sizes of TB-500 (thymosin beta-4 acetate) meet the same specification?
Yes. Each size is released against the one list on this page (purity, identity, related substances, water, content); the box size changes the fill per vial and nothing else. Each box carries its own batch number and the certificate for that batch is on file.
Can sizes of TB-500 (thymosin beta-4 acetate) be mixed in one order?
Yes. One sealed box is the smallest quantity per size (50 of TB2, a special order), the order as a whole must reach $300.00 USD ($100.00 on a first order), and boxes of any size, or of any other compound, count toward it. A single order takes a volume discount on its goods: 5 percent from $5,000.00, 10 percent from $10,000.00, 15 percent from $20,000.00 and 20 percent from $50,000.00. Lifetime paid spend also moves the account up: Silver from $5,000.00 takes 3 percent off goods, Gold from $15,000.00 takes 6 percent off goods, Platinum from $50,000.00 takes 10 percent off goods, Diamond from $100,000.00 takes 15 percent off goods. Checkout takes the better of the two, never both.
What is TB-500 (thymosin beta-4 acetate), and what sizes is it supplied in?
TB-500 (thymosin beta-4 acetate) (CAS 77591-33-4) is a 43-residue peptide, sequence SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (n-terminal acetyl); molecular formula C212H350N56O78S, average mass about 4963.51 g/mol. Supplied for research use in 3 sizes, 2mg to 10mg, 10 vials a sealed box, from $68.00 a box ($0.990 /mg at the best size).
Accept this quote
Accepting confirms the terms below. The desk raises the order against them and sends a proforma invoice with the payment details. Nothing is charged until you pay against the proforma invoice the desk issues.
Decline this quote
This closes the quote. The price is not held afterwards, so if the requirement comes back it is priced again at current prices.
Report a shortage or damage
Tell us what arrived wrong and it is on the clock from today. Keep the carton and the packing material until it is settled: the carrier can ask to see them, and we file the freight claim rather than you.
Send this first, then reply to the email it sends you with photographs of the outer carton and the vials. Sending it now is what stops the clock.
Request a cancellation
The desk reviews cancellations the same business day. Until it confirms, the order keeps moving. Once boxes are packed a cancellation is treated as a return.
Reset your password
Give us the address on the account and we will send a link that lets you set a new password. The link works once and expires after an hour.